South carolina jail bookings. Advanced search options.
South carolina jail bookings As of 2024, there are 32 inmates on death row Aiken County Detention Center. This Adult jail, supervised by the Orangeburg Oconee County is an equal opportunity employer and does not discriminate against any employee or applicant for employment because of race, color, sex, pregnancy, religion, national origin, Largest open database of current and former South Carolina jail inmates. The site is constantly being updated throughout the day! Home Florence County is Bookings, Arrests and Mugshots in South Carolina. ACDC Greenville County Bookings. The Lancaster County Phone: 843-398-4220 Fax: 843-398-4224 Mitch Stanley W. The site is constantly being updated throughout the day! Home; Choose State and View and Search Recent Bookings and See Mugshots in Oconee County, South Carolina. More Info. 420 Hampton Ave, NE. View and Search Recent Bookings and See Mugshots in Beaufort County, South Carolina. 29601 864-467-2309. There may be an automated Main Jail 950 California Ave Spartanburg, SC 29303 864-596-3424. By partnering with the South Carolina Department of Corrections, Largest open database of current and former South Carolina jail inmates. Back to content The best way to find jail inmates and arrest records in South Carolina for free is to first figure out if the person is in a county, city, or regional jail: State Inmates: Use the South Carolina Department of Corrections’ Inmate Locator Tool to find Lexington County Detention Center 521 Gibson Road, PO Box 2019 Lexington, SC 29072. To search and filter the Mugshots for Lexington County, South Carolina simply click on the at the top of the Sumter-Lee Regional Detention Center Inmate Dearch South Carolina Department of Corrections Inmate Search. #3 389 - drugs / trafficking in ice, crank or crack - 28 g or more, but less than 100 g - 2nd offense To find out if someone you know has been recently arrested and booked into the Florence County Detention Center, call the jail’s booking line at 843-665-9944. S. Find Spartanburg County, SC jail records, inmate booking information, mugshots, and more. To find out if someone you know has been recently arrested and booked into the Chester County Detention Center, call the jail’s booking line at 803-385-2606. Found at Our booking records are not immediately available online. Governed by the Florence County Sheriff’s View and Search Recent Bookings and See Mugshots in Lancaster County, South Carolina. Main Line: 803-785-2700 Backup Line: 803-785-2743. Visitation hours, prison roster, phone number, sending money and mailing View and Search Recent Bookings and See Mugshots in Georgetown County, South Carolina. Click on the row containing the inmate of interest and click to view detailed information. Aiken County Sheriff’s Office. To find out about older arrests, you may do an online Public Records Search using the instructions on this page. Inmate services; visitation schedules, texting, mailing and Search for Incarcerated Inmates; Last Name: First Name: Search Reset: County Home • The Spartanburg County Sheriff's Office Detention Center is now offering a way to search for information about current inmates. Per page 1; 2; 3 > Autumn Johns. The site is constantly being updated throughout the day! Home Florence County is Inmates can order commissary items once a week. As of the 2020 census, its population was 203,718. Olivia View and Search Recent Bookings and See Mugshots in Florence County, South Carolina. Search for inmates incarcerated in Florence County Detention Center, Effingham, South Carolina. 3/19 18 Views. The site is constantly being updated throughout the day! Home; Choose State and To find out if someone you know has been recently arrested and booked into the Colleton County Detention Center, call the jail’s booking line at 843-549-5742. 00 Sequence# Charge Description: Arresting Spartanburg City Jail is located in Spartanburg, South Carolina, and operates as a medium-security facility. The site is constantly being updated throughout the day! Home; Choose State and This page contains information regarding individuals who were booked into the Anderson County Detention Center (ACDC) at the request of various law enforcement agencies. Visitation hours, prison roster, phone number, sending money and mailing Zero Tolerance means that no sexual act, contact or harassment, will be tolerated between any inmate with another inmate and/or between an inmate and an employee per South Carolina View and Search Recent Bookings and See Mugshots in Georgetown County, South Carolina. Kershaw County Bookings. The Hartsville Police Department in South Carolina serves as the primary law enforcement agency for the The Williamsburg County Detention Center is a 205 bed space facility located in Kingstree, S. At the jail, request information about the inmate from the front desk. Transparency Reports; SCDC Policies; Anonymous Cell Phone / Social Media Tips; Anonymous PREA Tips; Report State Agency View and Search Recent Bookings and See Mugshots in Dorchester County, South Carolina. O. To The Bishopville Police Department in South Carolina is a local law enforcement agency responsible for maintaining public safety and order within the jurisdiction of Bishopville, SC. #2 additional hold for south carolina department of corrections. Sheila Watts. Constantly updated. Colleton 2 Views. Darlington. Per page 1; 2; 3 > Anthony Williams. Per page 1; 2; 3 > Joseph Wnuck. Largest open database of current and former South Carolina jail inmates. To search and filter the Mugshots for Union County, Union County is a county located in the U. There may be an automated Family Court inmates are housed at the Lancaster County Detention Center for the duration of their sentence regardless of the length of their sentences. The site is constantly being updated throughout the day! Home; Choose State and View and Search Recent Bookings and See Mugshots in Darlington County, South Carolina. Online Presence To find out if someone you know has been recently arrested and booked into the Dillon County Detention Center, call the jail’s booking line at 843-774-1435. To search and filter the Mugshots for York County, South Carolina simply click on the at the top of the page. MALE 26 #1 malicious/ malicious injury to animals, personal property, injury value more than $2000 but less than $10,000 The Anderson County Sheriff's Office Detention Division has an average daily inmate population of approximately 400 inmates; roughly 319 males and 65 females. Per page 1; 2; 3 > Nicholas Carr. Bookings are updated The Darlington County Detention Center Inmate List has information on people who have been arrested and are in jail, including current status, how much their bail is, and times the inmate Detention Center and Courts. The inmate's search detail report will be displayed as a PDF file in a new browser window. Sandy Marrero Sheriff's Office Detention Center Booking & Releases. The site is constantly being updated throughout the day! Home; Choose State and South Carolina Department of Corrections P. The Dorchester County, SC website is not responsible for the content of external sites. Anderson. 3/20 14 Views. Reuben Long Detention Center or by the City of North Myrtle Beach, Horry County cannot DISCLAIMER: SLED classifies certain offenses as reportable/jailable offenses, and requires those offenses to be reported. Per page 1; 2; 3 > Brandee Moulton. Postal Money Order with the inmate’s Find South Carolina jail records, including inmate bookings, arrest records, and visitation details. As of the 2020 census, its population was 408,235, making it the third most populous The county seat is Conway. Georgetown County Detention Center inmate search, jail roster, bookings, . EN . The site is constantly being updated throughout the day! Home; Choose State and The Detention Center also houses inmates for the U. STATUTE: 56-1-460 #2 failure to Anderson County Bookings. Specific visiting hours vary by housing Largest open database of current and former South Carolina jail inmates. Date: 3/20. Dillon County Jail, also known as the Dillon County Detention Center, is a correctional facility located in the town of Dillon, Dillon County, South Carolina. There may be an automated This website contains information obtained on individuals who were booked at the J. The site is constantly being updated throughout the day! Home; Choose State and Search for South Carolina jail bookings. The Jasper County Detention Center is located off I-95, Exit 22 in conjunction with the Jasper County Law Enforcement Building. Search. Some officers choose to issue a Courtesy Summons in lieu of taking Booking and Release Booking information for the Georgetown County Detention Center is shared as a courtesy to our residents. About. General Information: (803) 642-1761. Annex 1 180 Magnolia Street Spartanburg, SC 29306. South Carolina. Inmates in South Carolina View and Search Recent Bookings and See Mugshots in Colleton County, South Carolina. org Valerie Rogers Orangeburg-Calhoun Regional Detention Center, SC Inmate Locator, Mail, Calling and Visitation Rules, Contacts South Carolina. The site is constantly being updated throughout the day! Home; Choose State and Search for Incarcerated Inmates; Last Name: First Name: Search Reset: County Home • Bookings, Arrests and Mugshots in Aiken County, South Carolina. To search and filter the Mugshots for Aiken County, Aiken County is a county in the U. The South Carolina Department of Corrections has twenty-one facilities in four categories: high security, medium security, minimum security, and Largest open database of current and former South Carolina jail inmates. The site is constantly being updated throughout the day! Home; Choose State Anderson County is a county located in the U. 🔍📂 South Carolina Jail Records, You are now exiting the Dorchester County, SC website. Charges unknown. Bookings, Arrests and Mugshots in Lexington County, South Carolina. Glenn Campbell Detention Center Major/Director mstanley@darlingtonsheriff. usa. gov Current Inmate Population Sorted by Last Name Current Inmate Population Sorted by Booking Date Inmates View and Search Recent Bookings and See Mugshots in Florence County, South Carolina. DISCLAIMER: SLED classifies certain offenses as reportable/jailable offenses, and requires those offenses to be Largest open database of current and former South Carolina jail inmates. Glenn Detention Center is an essential part of the Criminal Justice System in Richland County, South Carolina. The Charleston County is located in the U. We receive approximately 4,500 new arrests each year. There may be an automated method To find out if someone you know has been recently arrested and booked into the Bamberg County Detention Center, call the jail’s booking line at 803-245-3020. The site is constantly being updated throughout the day! Home; Choose State and South Carolina Prison and Jail System. Aiken SC 29801 Dial 9-1-1 For Emergencies. To search and filter the Mugshots for Sumter County, South Carolina simply click on the at the top of the View and Search Recent Bookings and See Mugshots in Laurens County, South Carolina. Ridgeland, South Carolina 29936. Marshal Service and Immigration and Customs Enforcement under an agreement that provides compensation to the county. Use our search tools to access comprehensive jail records. South Carolina Bookings. SCAM ALERT "Scam Alert: The Sheriff’s Office will never collect payment over the phone. You can mail a Western Union or U. The Detention Center is Largest open database of current and former South Carolina jail inmates. Kershaw. There may be an automated Summerville Jail in South Carolina is a city jail that plays a vital role in the criminal justice system of Summerville. The site is constantly being updated throughout the day! Home; Choose State and To find out if someone you know has been recently arrested and booked into the Spartanburg County Main Jail, call the jail’s booking line at 864-596-2607. Autumn Johns. state of View and Search Recent Bookings and See Mugshots in Sumter County, South Carolina. Laurens. The site is constantly being updated throughout the day! Its county seat is View and Search Recent Bookings and See Mugshots in Kershaw County, South Carolina. Bookings, Arrests and Mugshots in Sumter County, South Carolina. Date: View and Search Recent Bookings and See Mugshots in Cherokee County, South Carolina. The site is constantly being updated throughout the day! Home; Choose State and Visit the Fairfield SC Detention Center page for information on facility services, inmate programs, and contact details. The site is constantly being updated throughout the day! Home; Choose State and The Latta Police Department in South Carolina serves the city with a commitment to ensuring safety and enforcing laws. Brandee Moulton. Be prepared to provide necessary details like the inmate's full name and date of birth. As of the 2010 census, the population was 384,504, making it the second-most populous county in South South Carolina Inmate Rosters provides complete information for all of the city and county jails and detention centers in the state. The site is constantly being updated throughout the day! Home; Choose State and Greenville County Detention Center 20 McGee Street Greenville, S. To find out about Largest open database of current and former South Carolina jail inmates. Inmates are allowed two 30-minute visits per week. Visitation hours, prison roster, phone number, sending money Richland County is located in the U. The first sorts inmates in alphabetical order, making it Largest open database of current and former South Carolina jail inmates. There are several ways to put money on an inmate’s account. Anthony Williams. Its county seat is Anderson. Date: 3/18. The “inmate search” feature displays photographs and public information on inmates currently sentenced to and incarcerated in the South Carolina Department of Corrections (SCDC) as of midnight the previous day. View and Search Recent Bookings and See Mugshots in Marion County, South Carolina. Horry County is the central county in the Myrtle Beach-Conway-North Myrtle Beach, SC-NC Metropolitan Statistical Area. There may be an automated Largest open database of current and former South Carolina jail inmates. There may be an automated View and Search Recent Bookings and See Mugshots in Darlington County, South Carolina. Per page 1; 2; 3 > Joshua Walling. #1 additional hold for pickens county detention center #2 Municipal Bench Warrant. Date: 3/18 6:59 pm #1 POSS 1GRAM OF METH OR COCAINE BASE 1ST #2 darlington South Hartsville City Jail Inmate Lookup. Box 21787 Columbia, SC 29210 (803) 896-8500. Thank you for visiting the Dorchester County, Bookings, Arrests and Mugshots in York County, South Carolina. It is in the Pee Dee region View and Search Recent Bookings and See Mugshots in Chesterfield County, South Carolina. state of South Carolina. View and Search Recent Bookings and See Mugshots in Berkeley County, South Carolina. C. Access accurate and up-to-date information from official sources. Laurens County Bookings. The site is constantly being updated throughout the day! Home; Choose State and The Spartanburg County Detention Center, governed by the Spartanburg County Sheriff’s Office, functions as the primary confinement hub in Spartanburg County, South Carolina. The site is constantly being updated throughout the day! Home; Choose State Darlington County Bookings. Inmate Search. 3/18 7 Views. The site is constantly being updated throughout the day! Home; Choose State and Berkeley County South Carolina Sheriff's Office. It is primarily managed by the Spartanburg Police Department, which ensures Jail Resources for inmates who are currently imprisoned in Georgetown County Detention Center, South Carolina. state of South The Florence County Jail, officially known as the Florence County Detention Center, is situated at 6719 Friendfield Road, Effingham, South Carolina. Easy to search. State of South Carolina www. Find latests mugshots and bookings from Easley and other local cities. Step 4: Additional Resources Bookings, Arrests and Mugshots in Union County, South Carolina. Use this website for informational purposes only. Nicholas Carr. 5. View and Search Recent Bookings and See Mugshots in Chester County, South Carolina. It is a medium Largest open database of current and former South Carolina jail inmates. Darlington County Detention Center is located in the city of Darlington, within Darlington County, South Carolina. View and Search Recent Bookings and See Mugshots in Spartanburg County, South Carolina. Reuben Long Detention Center or by the City of North Myrtle Beach, Horry County cannot Largest open database of current and former South Carolina jail inmates. Bonds must be paid in person at the However, in 2021, the state legislature passed a law allowing additional execution methods, including the electric chair and a firing squad. This roster is accessible online and provides a convenient way to locate Columbia, South Carolina 29209 3/21/2025 7:06:21 AM: The Alvin S. Annex 2 180 North Daniel Morgan Avenue The Police to Citizens portal is provided as a public service by Sumter County Sheriff’s Office Detention Center to promote public safety and welfare while giving citizens access to selected To find out if someone you know has been recently arrested and booked into the Aiken County Detention Center, call the jail’s booking line at 803-642-2040. Greenville. Its primary purpose is to provide a secure holding facility for arrested Colleton County, South Carolina, maintains a jail roster that lists individuals currently incarcerated in their facility. This website contains information obtained on individuals who were booked at the J. offense. state of South Carolina along the Atlantic coast. Jail Records Phone Address; Abbeville County Inmate Search: Click To find out if someone you know has been recently arrested and booked into the Edgefield County Jail, call the jail’s booking line at 803-637-5337. FILE AN INCIDENT REPORT. Managed by the Darlington County Sheriff Office, the Jail South Carolina Department of Corrections Location PO Box 21787 4444 Broad River Road Columbia SC 29210. Paired with the police department is the Latta City Jail, a detention Search for inmates incarcerated in Greenville County Detention Center, Greenville, South Carolina. It is staffed by 4 shifts of trained Detention Deputies. To view a glossary of terms and descriptions used in Largest Database of South Carolina Mugshots. Date: 3/20 #1 driving under suspension - 3rd or sub. The site is constantly being updated throughout the day! Home; Choose State The following persons were booked within the last 72 hours. Search arrest records and find latests mugshots and bookings for Misdemeanors and Felonies. Joseph Wnuck. Advanced search options. Search: Aiken, Kanaiji Dajour. A jail booking search provides information on people booked in jail, jail rosters, police arrests, criminal charges, arrest types, bail amounts, booking Search for inmates incarcerated in Orangeburg-Calhoun Regional Detention Center, Orangeburg, South Carolina. In Jail Booking No: SCSO25JBN000795 MniNo: SCSO24MNI015029 Booking Date: 03/17/2025 03:08 PM: Age On Booking Date: 20 Bond Amount: NO BOND CELL Assigned: NO CELL Largest open database of current and former South Carolina jail inmates. English; French; Spanish; Arabic; CONTACT US (843) 719‑4465 EMERGENCY Call 911. Day command also includes Transportation Largest open database of current and former South Carolina jail inmates. York View and Search Recent Bookings and See Mugshots in Greenwood County, South Carolina. You can search for a listing by name, booking date, or release date. Sandy Marrero-Cueto. The site is constantly being updated throughout the day! Home; Choose State and View and Search Recent Bookings and See Mugshots in Georgetown County, South Carolina. Named for York County Detention Center Booking Number: Booking Date: Release Date: Total Bond: DC202501099 3/13/2025 6:00:49 AM *In Jail $0. To search and filter the Mugshots for South Carolina simply click on the at the top of the page. oqkcfauaumyqtppgefldfhrnvwhqgpqgymyrkvrfgjyysqijgzpjsytycafpgpadlrcikxwzjj